Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d042639_circ_g.3 |
ID in PlantcircBase | zma_circ_007714 |
Alias | Zm03circ00064, GRMZM2G129444_C1 |
Organism | Zea mays |
Position | chr3: 174877179-174878114 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d042639 |
Parent gene annotation |
Mitotic spindle checkpoint protein MAD1 |
Parent gene strand | - |
Alternative splicing | Zm00001d042639_circ_g.1 Zm00001d042639_circ_g.2 Zm00001d042639_circ_g.4 Zm00001d042639_circ_g.5 Zm00001d042639_circ_g.6 Zm00001d042639_circ_g.7 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d042639_T006:4 Zm00001d042639_T003:4 Zm00001d042639_T009:4 Zm00001d042639_T004:4 Zm00001d042639_T002:4 Zm00001d042639_T010:4 Zm00001d042639_T007:4 Zm00001d042639_T008:4 Zm00001d042639_T005:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.070948424 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
174877355-174878092(-) 174877416-174878099(-) |
Potential amino acid sequence |
MPKAMMKSLSLTMNQEALISWSTITHPNKKLLGRSWNRGRR*(-) MNDQQQSNGIPVTRFILQSVYAQSDDEKLEFDYESGSTNIVVNDYTSQQEIARQILEPW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |