Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042639_circ_g.3 |
| ID in PlantcircBase | zma_circ_007714 |
| Alias | Zm03circ00064, GRMZM2G129444_C1 |
| Organism | Zea mays |
| Position | chr3: 174877179-174878114 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d042639 |
| Parent gene annotation |
Mitotic spindle checkpoint protein MAD1 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d042639_circ_g.1 Zm00001d042639_circ_g.2 Zm00001d042639_circ_g.4 Zm00001d042639_circ_g.5 Zm00001d042639_circ_g.6 Zm00001d042639_circ_g.7 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d042639_T006:4 Zm00001d042639_T003:4 Zm00001d042639_T009:4 Zm00001d042639_T004:4 Zm00001d042639_T002:4 Zm00001d042639_T010:4 Zm00001d042639_T007:4 Zm00001d042639_T008:4 Zm00001d042639_T005:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.070948424 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
174877355-174878092(-) 174877416-174878099(-) |
| Potential amino acid sequence |
MPKAMMKSLSLTMNQEALISWSTITHPNKKLLGRSWNRGRR*(-) MNDQQQSNGIPVTRFILQSVYAQSDDEKLEFDYESGSTNIVVNDYTSQQEIARQILEPW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |