Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0409600_circ_g.3 |
ID in PlantcircBase | osa_circ_023756 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 20252767-20254636 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os04g0409600 |
Parent gene annotation |
Similar to Histone deacetylase. (Os04t0409600-01) |
Parent gene strand | + |
Alternative splicing | Os04g0409600_circ_g.4 Os04g0409600_circ_g.5 Os04g0409600_circ_g.6 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0409600-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145228173 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20252772-20252796(+) 20254124-20254589(-) |
Potential amino acid sequence |
MTVSFHKYGDFFFPGTGDIKDIGEREGKYYAINIPLKDGIDDSGFTRLFKTVIAKVVETYLPGA IVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGYTKENVARCWAVETGVLL DTELPNEIPDNEYIKYFAPDYTLKVSNVNMGNDCKFPQVW*(+) MAFNGQIEAPQTVPCQGISPALKNNSTWQICLNNFGNNCFKKASKAGVIYPIFKWNVNGIIFSF SFSYILNITCAREEKITILVETYSHYPCSHSILSMYNLEQSI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |