Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0409600_circ_g.3 |
| ID in PlantcircBase | osa_circ_023756 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 20252767-20254636 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os04g0409600 |
| Parent gene annotation |
Similar to Histone deacetylase. (Os04t0409600-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0409600_circ_g.4 Os04g0409600_circ_g.5 Os04g0409600_circ_g.6 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0409600-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145228173 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20252772-20252796(+) 20254124-20254589(-) |
| Potential amino acid sequence |
MTVSFHKYGDFFFPGTGDIKDIGEREGKYYAINIPLKDGIDDSGFTRLFKTVIAKVVETYLPGA IVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGYTKENVARCWAVETGVLL DTELPNEIPDNEYIKYFAPDYTLKVSNVNMGNDCKFPQVW*(+) MAFNGQIEAPQTVPCQGISPALKNNSTWQICLNNFGNNCFKKASKAGVIYPIFKWNVNGIIFSF SFSYILNITCAREEKITILVETYSHYPCSHSILSMYNLEQSI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |