Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G29010_circ_g.19 |
ID in PlantcircBase | ath_circ_033445 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 14301523-14301804 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G29010 |
Parent gene annotation |
Peroxisomal fatty acid beta-oxidation multifunctional protein AI M1 |
Parent gene strand | - |
Alternative splicing | AT4G29010_circ_g.1 AT4G29010_circ_g.2 AT4G29010_circ_g.3 AT4G29010_circ_g.4 AT4G29010_circ_g.5 AT4G29010_circ_g.6 AT4G29010_circ_g.7 AT4G29010_circ_g.8 AT4G29010_circ_g.9 AT4G29010_circ_g.10 AT4G29010_circ_g.11 AT4G29010_circ_g.12 AT4G29010_circ_g.13 AT4G29010_circ_g.14 AT4G29010_circ_g.15 AT4G29010_circ_g.16 AT4G29010_circ_g.17 AT4G29010_circ_g.18 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G29010.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.156057422 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14301530-14301801(+) |
Potential amino acid sequence |
MNLLKDIDIKTTRKSSIVPDQHDGLNIIPLIGVTKLLLQPRNNSLMNLLKDIDIKTTRKSSIVP DQHDGLNIIPLIGVTKLLLQPRNNSLMNLLKDIDIKTTRKSSIVPDQHDGLNIIPLIGVTKLLL QPRNNSLMNLLKDIDIKTTRKSSIVPDQHDGLNIIPLIGVTKLLLQPRN(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |