Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G29010_circ_g.3 |
| ID in PlantcircBase | ath_circ_033429 |
| Alias | At_ciR4127 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 14297682-14298206 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT4G29010 |
| Parent gene annotation |
Peroxisomal fatty acid beta-oxidation multifunctional protein AI M1 |
| Parent gene strand | - |
| Alternative splicing | AT4G29010_circ_g.1 AT4G29010_circ_g.2 AT4G29010_circ_g.4 AT4G29010_circ_g.5 AT4G29010_circ_g.6 AT4G29010_circ_g.7 AT4G29010_circ_g.8 AT4G29010_circ_g.9 AT4G29010_circ_g.10 AT4G29010_circ_g.11 AT4G29010_circ_g.12 AT4G29010_circ_g.13 AT4G29010_circ_g.14 AT4G29010_circ_g.15 AT4G29010_circ_g.16 AT4G29010_circ_g.17 AT4G29010_circ_g.18 AT4G29010_circ_g.19 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G29010.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.169873113 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14298174-14297684(-) |
| Potential amino acid sequence |
MILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADTVGPKYIYERLKKLSET YGSFFKPSRYLEERAMNGMLLPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLG MSFPSYRGGIVFWADTVGPKYIYERLKKLSETYGSFFKPSRYLEERAMNGMLLPISVTDKEIVE MILFPVVNEACRVLDEGVVIRASDLDIASVLGMSFPSYRGGIVFWADTVGPKYIYERLKKLSET YGSFFKPSRYLEERAMNGMLLPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLG MSFPSYRGGIVFWADTVGPKYIYERLKKLSETYGSFFKPSRYLEERAMNGMLL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |