Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G01670_circ_g.8 |
ID in PlantcircBase | ath_circ_035920 |
Alias | AT5G01670_C1 |
Organism | Arabidpsis thaliana |
Position | chr5: 252762-252968 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, CIRI2 |
Parent gene | AT5G01670 |
Parent gene annotation |
NAD(P)-linked oxidoreductase superfamily protein |
Parent gene strand | + |
Alternative splicing | AT5G01670_circ_g.1 AT5G01670_circ_g.2 AT5G01670_circ_g.3 AT5G01670_circ_g.4 AT5G01670_circ_g.5 AT5G01670_circ_g.6 AT5G01670_circ_g.7 AT5G01670_circ_g.9 AT5G01670_circ_g.10 AT5G01670_circ_g.11 |
Support reads | 2 |
Tissues | root, aerial, whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G01670.2:1 AT5G01670.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.487036591 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
252834-252965(+) |
Potential amino acid sequence |
MEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQIHWPIRLREGASKPPKAGD VLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQIHWPIRLREGASKP PKAGDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQIHWPIRLRE GASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |