Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0737200_circ_g.6 |
ID in PlantcircBase | osa_circ_021748 |
Alias | Os_ciR2966 |
Organism | Oryza sativa |
Position | chr3: 30221794-30221928 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0737200 |
Parent gene annotation |
E3-ubiquitin ligase, Modulation of the cold stress response (Os0 3t0737200-01) |
Parent gene strand | - |
Alternative splicing | Os03g0737200_circ_g.1 Os03g0737200_circ_g.2 Os03g0737200_circ_g.3 Os03g0737200_circ_g.4 Os03g0737200_circ_g.5 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0737200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_001884 |
PMCS | 0.305559259 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30221802-30221796(-) |
Potential amino acid sequence |
MIYTTDVCLDENAVSSDPLLAFLLDEVVIKEWCKKAVNALISEINMIYTTDVCLDENAVSSDPL LAFLLDEVVIKEWCKKAVNALISEINMIYTTDVCLDENAVSSDPLLAFLLDEVVIKEWCKKAVN ALISEINMI(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |