Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0737200_circ_g.6 |
| ID in PlantcircBase | osa_circ_021748 |
| Alias | Os_ciR2966 |
| Organism | Oryza sativa |
| Position | chr3: 30221794-30221928 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0737200 |
| Parent gene annotation |
E3-ubiquitin ligase, Modulation of the cold stress response (Os0 3t0737200-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0737200_circ_g.1 Os03g0737200_circ_g.2 Os03g0737200_circ_g.3 Os03g0737200_circ_g.4 Os03g0737200_circ_g.5 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0737200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001884 |
| PMCS | 0.305559259 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30221802-30221796(-) |
| Potential amino acid sequence |
MIYTTDVCLDENAVSSDPLLAFLLDEVVIKEWCKKAVNALISEINMIYTTDVCLDENAVSSDPL LAFLLDEVVIKEWCKKAVNALISEINMIYTTDVCLDENAVSSDPLLAFLLDEVVIKEWCKKAVN ALISEINMI(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |