Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0316900_circ_g.1 |
| ID in PlantcircBase | osa_circ_001530 |
| Alias | Os_ciR2635 |
| Organism | Oryza sativa |
| Position | chr1: 11974551-11975195 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0316900 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0316900-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0316900_circ_g.2 Os01g0317125_circ_g.1 Os01g0317125_circ_g.2 Os01g0317125_circ_g.3 |
| Support reads | 5/3 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0316900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002006* osi_circ_009278 |
| PMCS | 0.327390181 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11974658-11974620(+) 11974660-11975177(-) |
| Potential amino acid sequence |
MAPAPAVDAEGECGGGKSHNTLKPDGVRVAAASTTLDSSDSHGPAADVQGGGGSGERLDSSDGE GRATDVQGRSSAGESLVVKSEHACAADDPVGDGALLAPANKPTGADPLAVASSSHDIDAASADP ANDEEDGDTTECSSSFGNSCCETDDEADHGGSEVDSPFSENADGVQALIRPRCRGGFLDSGAVL LRGIPDFLAEF*(+) MAGRCTSQQPGNQNSAKKSGIPLSKTAPESRKPPRHLGRINA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |