Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0316900_circ_g.1 |
ID in PlantcircBase | osa_circ_001530 |
Alias | Os_ciR2635 |
Organism | Oryza sativa |
Position | chr1: 11974551-11975195 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0316900 |
Parent gene annotation |
Conserved hypothetical protein. (Os01t0316900-01) |
Parent gene strand | + |
Alternative splicing | Os01g0316900_circ_g.2 Os01g0317125_circ_g.1 Os01g0317125_circ_g.2 Os01g0317125_circ_g.3 |
Support reads | 5/3 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0316900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002006* osi_circ_009278 |
PMCS | 0.327390181 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11974658-11974620(+) 11974660-11975177(-) |
Potential amino acid sequence |
MAPAPAVDAEGECGGGKSHNTLKPDGVRVAAASTTLDSSDSHGPAADVQGGGGSGERLDSSDGE GRATDVQGRSSAGESLVVKSEHACAADDPVGDGALLAPANKPTGADPLAVASSSHDIDAASADP ANDEEDGDTTECSSSFGNSCCETDDEADHGGSEVDSPFSENADGVQALIRPRCRGGFLDSGAVL LRGIPDFLAEF*(+) MAGRCTSQQPGNQNSAKKSGIPLSKTAPESRKPPRHLGRINA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |