Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0252400_circ_g.3 |
| ID in PlantcircBase | osa_circ_023209 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 9941058-9945840 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0252400 |
| Parent gene annotation |
Similar to SNARE-interacting protein KEULE. (Os04t0252400-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0252400_circ_g.1 Os04g0252400_circ_g.2 Os04g0252400_circ_g.4 Os04g0252400_circ_g.5 Os04g0252400_circ_g.6 Os04g0252400_circ_g.7 Os04g0252400_circ_g.8 Os04g0252400_circ_g.9 Os04g0252400_circ_g.10 Os04g0252400_circ_g.11 Os04g0252400_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0252400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015141 |
| PMCS | 0.098037341 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9945816-9941112(+) 9945818-9945815(-) |
| Potential amino acid sequence |
MSSADNPASLNTHHQSLEAWPMCHLSF*(+) MIAVSNMRCLCGHDSKKSSAGGFTLKFDLRKKRHGIRKERIGEESKWMLSRFYPILEELIEKLS KGELPKDEYHYLNDPSPSFRGIPSASTQTSPAHQPAQSMRSRRTGGTWARPRDSDDGYSSSQDY LLMT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |