Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0252400_circ_g.5 |
ID in PlantcircBase | osa_circ_023211 |
Alias | Os04circ01773/Os_ciR1980 |
Organism | Oryza sativa |
Position | chr4: 9945552-9948157 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
Parent gene | Os04g0252400 |
Parent gene annotation |
Similar to SNARE-interacting protein KEULE. (Os04t0252400-01) |
Parent gene strand | - |
Alternative splicing | Os04g0252400_circ_g.1 Os04g0252400_circ_g.2 Os04g0252400_circ_g.3 Os04g0252400_circ_g.4 Os04g0252400_circ_g.6 Os04g0252400_circ_g.7 Os04g0252400_circ_g.8 Os04g0252400_circ_g.9 Os04g0252400_circ_g.10 Os04g0252400_circ_g.11 Os04g0252400_circ_g.12 |
Support reads | 2/4/4 |
Tissues | leaf/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0252400-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015142 |
PMCS | 0.106701186 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9945587-9947805(-) 9948122-9948094(-) |
Potential amino acid sequence |
MDVVPVLSHPGEMVEIYQPKSCKKWFKLFRSTVIKLTSLRFMLRLLESSIAQLKSNN*(-) MVQALPQYSDQIDKLALHVEIAGKLNSTIKEQQLKDVGQLEQDLVFGDAGTKELINFFRTHLDI SRENKLRLLMVYAAINPDKTRSDKGAKLMQLAGLSADDMIAVSNMRCLCGHDSKKSSAGGFTLK FDLRKKRHGIRKERIGEESKWMLSRFYPILEKWWRFINQRVAKNGSSSSAVQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |