Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0549200_circ_g.3 |
ID in PlantcircBase | osa_circ_002117 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 20494577-20495966 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0549200 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0549200-01);ATPase-like, ATP- binding domain domain containing protein. (Os01t0549200-02);Hypo thetical conserved gene. (Os01t0549200-03) |
Parent gene strand | - |
Alternative splicing | Os01g0549200_circ_g.1 Os01g0549200_circ_g.2 Os01g0549200_circ_g.4 Os01g0549200_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0549200-01:3 Os01t0549200-02:3 Os01t0549200-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010068 |
PMCS | 0.112829718 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20494668-20494658(+) |
Potential amino acid sequence |
MKFASRMPTTPRPLPYELFATFQNGAIKRFLWYTLKPCTSISGAPLTNPMVVIADSSIHMSFLS SGSPAFDKGPTFQNLACHG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |