Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0549200_circ_g.1 |
| ID in PlantcircBase | osa_circ_002115 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 20491061-20493346 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0549200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0549200-01);ATPase-like, ATP- binding domain domain containing protein. (Os01t0549200-02);Hypo thetical conserved gene. (Os01t0549200-03) |
| Parent gene strand | - |
| Alternative splicing | Os01g0549200_circ_g.2 Os01g0549200_circ_g.3 Os01g0549200_circ_g.4 Os01g0549200_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0549200-02:4 Os01t0549200-03:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.097562806 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20493332-20492271(+) 20491105-20493266(-) 20493269-20493319(-) |
| Potential amino acid sequence |
MAMQVPSEQVVLLTPRIASIRHATYHSLVSKSCIR*(+) MLAIRGVSKTTCSEGTCIAIVLVMTTKNYLNLPVHLIVLIR*(-) MNAGSSPPIVPRQLLAADIPTSSCAVPTFMAPALRQKQMGLKRNIDALGSKTDSADQDGSHLDV SQRRRFNEYRTLTLENDKLRGECLQYEESAKQLALKGPALPSYWL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |