Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d008429_circ_g.5 |
ID in PlantcircBase | zma_circ_009541 |
Alias | zma_circ_0003013, GRMZM2G334457_C2 |
Organism | Zea mays |
Position | chr8: 8462644-8462912 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d008429 |
Parent gene annotation |
Paired amphipathic helix protein Sin3-like 3 |
Parent gene strand | - |
Alternative splicing | Zm00001d008429_circ_g.2 Zm00001d008429_circ_g.3 Zm00001d008429_circ_g.4 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d008429_T018:1 Zm00001d008429_T006:1 Zm00001d008429_T020:1 Zm00001d008429_T017:1 Zm00001d008429_T014:1 Zm00001d008429_T024:1 Zm00001d008429_T043:1 Zm00001d008429_T029:1 Zm00001d008429_T040:1 Zm00001d008429_T028:1 Zm00001d008429_T042:1 Zm00001d008429_T012:1 Zm00001d008429_T026:1 Zm00001d008429_T030:1 Zm00001d008429_T025:1 Zm00001d008429_T036:1 Zm00001d008429_T021:1 Zm00001d008429_T019:1 Zm00001d008429_T010:1 Zm00001d008429_T027:1 Zm00001d008429_T041:1 Zm00001d008429_T035:1 Zm00001d008429_T008:1 Zm00001d008429_T015:1 Zm00001d008429_T004:1 Zm00001d008429_T002:1 Zm00001d008429_T007:1 Zm00001d008429_T032:1 Zm00001d008429_T003:1 Zm00001d008429_T013:1 Zm00001d008429_T022:1 Zm00001d008429_T038:1 Zm00001d008429_T034:1 Zm00001d008429_T033:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.222558682 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8462750-8462893(-) |
Potential amino acid sequence |
MFSGKEKYNLSKPISELDLSNCQRCTPSYRLLPKNAQQQGLLKLRIKKRIEIGTGRTGIEIGKR KERRNEKDSIKGQHSIQRTVLVTNLLCFLAKRSTTYPNQYQSLISQTVNVALRVTGFYLKMPNN KDC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |