Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d008429_circ_g.3 |
ID in PlantcircBase | zma_circ_009540 |
Alias | Zm08circ00004, zma_circ_0002639, GRMZM2G334457_C1 |
Organism | Zea mays |
Position | chr8: 8462416-8463479 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d008429 |
Parent gene annotation |
Paired amphipathic helix protein Sin3-like 3 |
Parent gene strand | - |
Alternative splicing | Zm00001d008429_circ_g.2 Zm00001d008429_circ_g.4 Zm00001d008429_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d008429_T042:5 Zm00001d008429_T022:5 Zm00001d008429_T015:5 Zm00001d008429_T030:5 Zm00001d008429_T019:5 Zm00001d008429_T041:2 Zm00001d008429_T028:5 Zm00001d008429_T014:4 Zm00001d008429_T025:5 Zm00001d008429_T008:5 Zm00001d008429_T012:5 Zm00001d008429_T021:5 Zm00001d008429_T033:5 Zm00001d008429_T020:5 Zm00001d008429_T006:5 Zm00001d008429_T018:2 Zm00001d008429_T026:5 Zm00001d008429_T034:5 Zm00001d008429_T038:5 Zm00001d008429_T029:5 Zm00001d008429_T043:4 Zm00001d008429_T002:5 Zm00001d008429_T027:5 Zm00001d008429_T032:5 Zm00001d008429_T017:4 Zm00001d008429_T003:5 Zm00001d008429_T035:5 Zm00001d008429_T040:4 Zm00001d008429_T013:5 Zm00001d008429_T010:5 Zm00001d008429_T036:5 Zm00001d008429_T007:5 Zm00001d008429_T024:5 Zm00001d008429_T004:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005881* |
PMCS | 0.211624797 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8463425-8462431(+) 8462451-8463451(-) 8463156-8463451(-) |
Potential amino acid sequence |
MLQFFLHLLTEMELVRVYTCHPRI*(+) MRKAYLDARMTGVYTHEFHFCEKVKEKLEHEAYQEFLKCLHIYSQEIITRSELKNLVNDILQHY PDLMEGFNEFLEHCENIDGFLAGVFNKRPTTRIVKTEDKEKDRDRDREDRDRDREKEREKERER LDKGSTFNSKDGSCHKPPMFSGKEKYNLSKPISELDLSNCQRCTPSYRLLPKNYPMPPASNRTD LGASVLNDHWVSVTSGSEDYSFKHMRKNQYEESLFRCEDDRCIHARVPFL*(-) MEGFNEFLEHCENIDGFLAGVFNKRPTTRIVKTEDKEKDRDRDREDRDRDREKEREKERERLDK GSTFNSKDGSCHKPPMFSGKEKYNLSKPISELDLSNCQRCTPSYRLLPKNYPMPPASNRTDLGA SVLNDHWVSVTSGSEDYSFKHMRKNQYEESLFRCEDDRCIHARVPFL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |