Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G28620_circ_g.12 |
| ID in PlantcircBase | ath_circ_015416 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 12267894-12268276 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT2G28620 |
| Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT2G28620_circ_g.1 AT2G28620_circ_g.2 AT2G28620_circ_g.3 AT2G28620_circ_g.4 AT2G28620_circ_g.5 AT2G28620_circ_g.6 AT2G28620_circ_g.7 AT2G28620_circ_g.8 AT2G28620_circ_g.9 AT2G28620_circ_g.10 AT2G28620_circ_g.11 AT2G28620_circ_g.13 AT2G28620_circ_g.14 AT2G28620_circ_g.15 AT2G28620_circ_g.16 AT2G28620_circ_g.17 AT2G28620_circ_g.18 AT2G28620_circ_g.19 AT2G28620_circ_g.20 |
| Support reads | 1 |
| Tissues | inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G28620.1:3 AT2G28620.2:3 AT2G28620.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.249671499 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12268265-12267896(-) |
| Potential amino acid sequence |
MMKSAIMKDLYSEIERLKQEVYAAREKNGIYIPKERYTQEEAEKKAMADKIEQMEVEGEAKDKV NQKMMKSAIMKDLYSEIERLKQEVYAAREKNGIYIPKERYTQEEAEKKAMADKIEQMEVEGEAK DKVNQKMMKSAIMKDLYSEIERLKQEVYAAREKNGIYIPKERYTQEEAEKKAMADKIEQMEVEG EAKDKVNQKMMKSAIMKDLYSEIERLKQEVYAAREKNGIYIPKERYTQEEAEKKAMADKIEQME VEGEAKDK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |