Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0691700_circ_g.1 |
ID in PlantcircBase | osa_circ_003438 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 28556511-28556837 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0691700 |
Parent gene annotation |
Similar to Serine/threonine protein phosphatase 2A. (Os01t069170 0-01) |
Parent gene strand | + |
Alternative splicing | Os01g0691700_circ_g.2 Os01g0691700_circ_g.3 Os01g0691700_circ_g.4 Os01g0691700_circ_g.5 Os01g0691700_circ_g.6 Os01g0691700_circ_g.7 Os01g0691700_circ_g.8 Os01g0691700_circ_g.9 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0691700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.335107926 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28556605-28556511(+) 28556583-28556812(-) 28556632-28556647(-) |
Potential amino acid sequence |
MKLFATGGHVPETNYIFMGDFVDRGFNSLEVFTILLLLKAR*(+) MSPHTVTGLFTGCTLDSSMRISFTSLLVATEW*(-) MPPSREELHQVMELPMDVSAHGHRAVHWLHVGLLDEDLLHLAFSSNRMVKTSRLLKPRSTKSPM KI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |