Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0691700_circ_g.1 |
| ID in PlantcircBase | osa_circ_003438 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28556511-28556837 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0691700 |
| Parent gene annotation |
Similar to Serine/threonine protein phosphatase 2A. (Os01t069170 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0691700_circ_g.2 Os01g0691700_circ_g.3 Os01g0691700_circ_g.4 Os01g0691700_circ_g.5 Os01g0691700_circ_g.6 Os01g0691700_circ_g.7 Os01g0691700_circ_g.8 Os01g0691700_circ_g.9 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0691700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.335107926 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28556605-28556511(+) 28556583-28556812(-) 28556632-28556647(-) |
| Potential amino acid sequence |
MKLFATGGHVPETNYIFMGDFVDRGFNSLEVFTILLLLKAR*(+) MSPHTVTGLFTGCTLDSSMRISFTSLLVATEW*(-) MPPSREELHQVMELPMDVSAHGHRAVHWLHVGLLDEDLLHLAFSSNRMVKTSRLLKPRSTKSPM KI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |