Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G32410_circ_g.9 |
ID in PlantcircBase | ath_circ_034044 |
Alias | At_ciR1338 |
Organism | Arabidpsis thaliana |
Position | chr4: 15643133-15643477 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | AT4G32410 |
Parent gene annotation |
Cellulose synthase |
Parent gene strand | - |
Alternative splicing | AT4G32410_circ_g.2 AT4G32410_circ_g.3 AT4G32410_circ_g.4 AT4G32410_circ_g.5 AT4G32410_circ_g.6 AT4G32410_circ_g.7 AT4G32410_circ_g.8 AT4G32410_circ_g.10 AT4G32410_circ_g.11 AT4G32410_circ_g.12 AT4G32410_circ_g.13 AT4G32410_circ_g.14 AT4G32410_circ_g.15 AT4G32410_circ_g.16 AT4G32410_circ_g.17 AT4G32410_circ_g.18 AT4G32410_circ_g.19 AT4G32410_circ_g.20 AT4G32410_circ_g.21 AT4G32410_circ_g.22 |
Support reads | 3/8 |
Tissues | leaf/seedlings |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G32410.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.360293509 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15643400-15643135(-) |
Potential amino acid sequence |
MQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHKKAGAMNALRE YEEFKVRINALVAKAQKIPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLI YVSREKRPGFQHHKKAGAMNALREYEEFKVRINALVAKAQKIPEEGWTMQDGTPWPGNNTRDHP GMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHKKAGAMNALREYEEFKVRINALVAKAQ KIPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHKKA GAMNAL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to heat stress |
Other Information | |
---|---|
References | Ye et al., 2015;Pan et al., 2017 |