Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G32410_circ_g.9 |
| ID in PlantcircBase | ath_circ_034044 |
| Alias | At_ciR1338 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 15643133-15643477 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | AT4G32410 |
| Parent gene annotation |
Cellulose synthase |
| Parent gene strand | - |
| Alternative splicing | AT4G32410_circ_g.2 AT4G32410_circ_g.3 AT4G32410_circ_g.4 AT4G32410_circ_g.5 AT4G32410_circ_g.6 AT4G32410_circ_g.7 AT4G32410_circ_g.8 AT4G32410_circ_g.10 AT4G32410_circ_g.11 AT4G32410_circ_g.12 AT4G32410_circ_g.13 AT4G32410_circ_g.14 AT4G32410_circ_g.15 AT4G32410_circ_g.16 AT4G32410_circ_g.17 AT4G32410_circ_g.18 AT4G32410_circ_g.19 AT4G32410_circ_g.20 AT4G32410_circ_g.21 AT4G32410_circ_g.22 |
| Support reads | 3/8 |
| Tissues | leaf/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G32410.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.360293509 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15643400-15643135(-) |
| Potential amino acid sequence |
MQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHKKAGAMNALRE YEEFKVRINALVAKAQKIPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLI YVSREKRPGFQHHKKAGAMNALREYEEFKVRINALVAKAQKIPEEGWTMQDGTPWPGNNTRDHP GMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHKKAGAMNALREYEEFKVRINALVAKAQ KIPEEGWTMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTDGNELPRLIYVSREKRPGFQHHKKA GAMNAL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to heat stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Pan et al., 2017 |