Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0224200_circ_g.3 |
| ID in PlantcircBase | osa_circ_013923 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 6965279-6966663 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0224200 |
| Parent gene annotation |
Similar to Ser/Thr specific protein phosphatase 2A B regulatory subunit beta isoform. (Os02t0224200-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0224200_circ_g.1 Os02g0224200_circ_g.2 Os02g0224200_circ_g.4 Os02g0224200_circ_g.5 Os02g0224200_circ_g.6 Os02g0224200_circ_g.7 Os02g0224200_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0224200-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012736 |
| PMCS | 0.174622684 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6965505-6966660(-) 6966273-6966626(-) |
| Potential amino acid sequence |
MLSEWGWTSCCNWLLQQFISCFWLYSWKCGGNHLGSKQKSYER*(-) MTLKLWDINMDSGPVATFQVHEYLRPKLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVF GCTPGSAEATTLEASRNPMRGDHMRGVPPNSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |