Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0503550_circ_g.9 |
ID in PlantcircBase | osa_circ_024489 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 25131580-25131818 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0503500 |
Parent gene annotation |
Leucine-rich repeat, cysteine-containing subtype containing prot ein. (Os04t0503500-01);Leucine-rich repeat, cysteine-containing subtype containing protein. (Os04t0503500-02) |
Parent gene strand | - |
Alternative splicing | Os04g0503550_circ_g.4 Os04g0503550_circ_g.5 Os04g0503550_circ_g.6 Os04g0503550_circ_g.7 Os04g0503550_circ_g.8 Os04g0503550_circ_g.10 Os04g0503550_circ_g.11 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0503550-00:2 Os04t0503500-01:2 Os04t0503550-00:2 Os04t0503500-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.307774791 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25131761-25131582(-) |
Potential amino acid sequence |
MKHLSDLTNLRELQLSCCKISDLGVSYLRGLRKLEKLNLRYCNGITDSDMKHLSDLTNLRELQL SCCKISDLGVSYLRGLRKLEKLNLRYCNGITDSDMKHLSDLTNLRELQLSCCKISDLGVSYLRG LRKLEKLNLRYCNGITDSDMKHLSDLTNLRELQLSCCKISDLGVSYLR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |