Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_10G104300_circ_g.1 |
| ID in PlantcircBase | gma_circ_006573 |
| Alias | gma-circRNA1363 |
| Organism | Glycine max |
| Position | chr10: 22650001-22650396 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_10G104300 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH33176:2 KRH33175:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017065 |
| PMCS | 0.390767698 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22650380-22650045(+) 22650084-22650361(-) |
| Potential amino acid sequence |
MLYKEGHTALLPIHRLEPILS*(+) MGIIKKATRNLLNLVLVPACESAIKLCGLLCRASPIRQE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |