Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_01G051300_circ_g.1 |
| ID in PlantcircBase | gma_circ_000054 |
| Alias | Gm01circRNA821, circRNA1616 |
| Organism | Glycine max |
| Position | chr1: 6061431-6061711 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI, CIRI, CIRCexplorer |
| Parent gene | GLYMA_01G051300 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | root, pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH74907:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | pop_circ_002335* |
| PMCS | 0.421905813 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6061489-6061533(+) 6061495-6061642(-) |
| Potential amino acid sequence |
MHNPICLETLWWLTLVKNQSLLHPYMLRPTIDCFICPSGLPIPRHGCSIRPHPIWILPLSWAKE VPLLFSKVCFILMDPTCLLACLLDPINLYSCIIQSVLRPFGGLPL*(+) MHEYRLIGSRRQANRQVGSMRIKQTLEKRSGTSLAHERGSIQMG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Ma et al., 2021a |