Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0008s08850_circ_g.1 |
| ID in PlantcircBase | pop_circ_002335 |
| Alias | Chr08:5582498|5582778 |
| Organism | Populus trichocarpa |
| Position | chr8: 5488944-5489224 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | POPTR_0008s08850 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem cambium |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0008s08850.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gma_circ_000054* |
| PMCS | 0.863962604 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5489002-5489046(+) 5489096-5489005(+) 5489008-5489155(-) |
| Potential amino acid sequence |
MHNPICLGTLWWPALVKNKSFLDTNIFRSAVDGLVCARGLPIPRHGCSVRPHSIWVLAVTRGKE VPLIFSKFCLLLMDPFCLLACFLGSFKRYSCIIQSVLAPFGGLPL*(+) MALSVPVAFQYPDTVALLGLTPFGYLRSRGVKKYHSFSPNSAFFSWIHFACWLVFLDHLSDTHA *(+) MHEYRLNDPRKQANKQNGSMRRRQNLEKMSGTSLPLVTASTQME*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zheng et al., 2020 |