Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0306000_circ_g.12 |
| ID in PlantcircBase | osa_circ_027355 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13845436-13845747 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0306000 |
| Parent gene annotation |
GOLD domain containing protein. (Os05t0306000-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0306000_circ_g.1 Os05g0306000_circ_g.2 Os05g0306000_circ_g.3 Os05g0306000_circ_g.4 Os05g0306000_circ_g.5 Os05g0306000_circ_g.6 Os05g0306000_circ_g.7 Os05g0306000_circ_g.8 Os05g0306000_circ_g.9 Os05g0306000_circ_g.10 Os05g0306000_circ_g.11 Os05g0306000_circ_g.13 Os05g0306000_circ_g.14 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0306000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002325 |
| PMCS | 0.364934295 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13845650-13845686(-) 13845747-13845744(-) |
| Potential amino acid sequence |
MLVEAFVIDMHCCGNSKWTGECNWHNLVLQQVYIRRLLGTWSVSLSYDLHATRFPWYTNQATAR TL*(-) MTYMPQDFRGTLIRQQRERSERNKQAEVDALVNAGGSIRDRYALLWKQQMDRRVQLAQLGSATG VYKTLVRYLVGVPQL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |