Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0306000_circ_g.12 |
ID in PlantcircBase | osa_circ_027355 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 13845436-13845747 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0306000 |
Parent gene annotation |
GOLD domain containing protein. (Os05t0306000-01) |
Parent gene strand | - |
Alternative splicing | Os05g0306000_circ_g.1 Os05g0306000_circ_g.2 Os05g0306000_circ_g.3 Os05g0306000_circ_g.4 Os05g0306000_circ_g.5 Os05g0306000_circ_g.6 Os05g0306000_circ_g.7 Os05g0306000_circ_g.8 Os05g0306000_circ_g.9 Os05g0306000_circ_g.10 Os05g0306000_circ_g.11 Os05g0306000_circ_g.13 Os05g0306000_circ_g.14 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0306000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002325 |
PMCS | 0.364934295 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13845650-13845686(-) 13845747-13845744(-) |
Potential amino acid sequence |
MLVEAFVIDMHCCGNSKWTGECNWHNLVLQQVYIRRLLGTWSVSLSYDLHATRFPWYTNQATAR TL*(-) MTYMPQDFRGTLIRQQRERSERNKQAEVDALVNAGGSIRDRYALLWKQQMDRRVQLAQLGSATG VYKTLVRYLVGVPQL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |