Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G16270_circ_g.1 |
ID in PlantcircBase | ath_circ_002880 |
Alias | AT1G16270_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 5566449-5566862 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, CIRI2 |
Parent gene | AT1G16270 |
Parent gene annotation |
F3O9.7 protein |
Parent gene strand | + |
Alternative splicing | AT1G16270_circ_g.2 AT1G16270_circ_g.3 |
Support reads | 2/3 |
Tissues | root, whole_plant/seedlings, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G16270.3:2 AT1G16270.1:2 AT1G16270.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.640283176 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5566716-5566859(+) |
Potential amino acid sequence |
MNDDLEELKELGSGTFGTVYHGKWRGSDVAIKRIKKSCFAGRSSEQERLDEKSETRNAGLPPVG PSLADYDTSGLQIIMNDDLEELKELGSGTFGTVYHGKWRGSDVAIKRIKKSCFAGRSSEQERLD EKSETRNAGLPPVGPSLADYDTSGLQIIMNDDLEELKELGSGTFGTVYHGKWRGSDVAIKRIKK SCFAGRSSEQERLDEKSETRNAGLPPVGPSLADYDTSGLQIIMNDDLEELKELGSGTFGTVYHG KWRGSDVAIKRIKKSCFAGRSSEQERL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Pan et al., 2017;Zhang et al., 2019 |