Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0182600_circ_g.1 |
ID in PlantcircBase | osa_circ_026877 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 4966608-4966793 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0182600 |
Parent gene annotation |
Similar to SSRP1 protein. (Os05t0182600-01) |
Parent gene strand | + |
Alternative splicing | Os05g0182600_circ_g.2 Os05g0182600_circ_g.3 Os05g0182600_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0182600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.236810842 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4966714-4966790(+) |
Potential amino acid sequence |
MAIPRSYQLGVSTKEGLFYRFFGFREQNPGQFKLYSGGLAWKRQGGGKTIEVEKSDITSVTWMA IPRSYQLGVSTKEGLFYRFFGFREQNPGQFKLYSGGLAWKRQGGGKTIEVEKSDITSVTWMAIP RSYQLGVSTKEGLFYRFFGFREQNPGQFKLYSGGLAWKRQGGGKTIEVEKSDITSVTWMAIPRS YQLGVSTKEGLFYRFFGFREQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |