Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0307400_circ_g.1 |
| ID in PlantcircBase | osa_circ_036649 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 12856350-12856730 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0307400 |
| Parent gene annotation |
Similar to Phosphatidylinositol 3-kinase 1. (Os08t0307400-01);Si milar to Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.1 37) (PI3- kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5). (Os08t0307 400-02);Similar to Phosphatidylinositol 3-kinase 1. (Os08t030740 0-03) |
| Parent gene strand | - |
| Alternative splicing | Os08g0307400_circ_g.2 Os08g0307400_circ_g.3 Os08g0307400_circ_g.4 Os08g0307400_circ_g.5 Os08g0307400_circ_g.6 Os08g0307400_circ_g.7 Os08g0307400_circ_g.8 Os08g0307400_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0307400-02:2 Os08t0307400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.354946409 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12856594-12856385(+) 12856634-12856401(+) 12856671-12856724(-) |
| Potential amino acid sequence |
MASTISLHNFIGGDGGANRCGCSPSIYEKSTWKSLPSSCRRRLSRCLRSPFVCDTLNI*(+) MVVQIDVVVPQAYTRSQHGKVFHRLVGEGCQDALEVPLSVILSIFDPVIR*(+) MLGEQPHRFAPPSPPMKLCKEMVEAMGGTESEYYARFKSYCCEAYNILRKSSNLILNLFYLMTG SNIESITDKGTSKAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |