Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0702800_circ_g.1 |
| ID in PlantcircBase | osa_circ_016134 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 28968113-28968448 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0702800 |
| Parent gene annotation |
Similar to Syntaxin 22 (AtSYP22) (AtVAM3). (Os02t0702800-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0702800_circ_g.2 Os02g0702800_circ_g.3 Os02g0702800_circ_g.4 Os02g0702800_circ_g.5 Os02g0702800_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0702800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374723313 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28968311-28968296(+) 28968427-28968427(-) |
| Potential amino acid sequence |
MHKCSKILKCFMYFTNLLLNILNSLLPFLNDSFIENNFIIQLQHLLPVMNSISESWTLSRVLSL PLWLLLQNSQCLYRFPRL*(+) MKLFSMKLSLRKGSKLFKIFNNRLVKYMKHLRILLHLCIFKELQSRKSIQTLRILQQQPKRQRQ NSRKRPRLRNRIHHWQEVLQLDNEIVFNEAIIEEREQAIQDIQQQIGEVHEAFKDLATLVHIQG VTIEEIDTNIENSAAATKEAKTELAKASKTQKSNSSLARGAAIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |