Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0362800_circ_g.2 |
| ID in PlantcircBase | osa_circ_038979 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 11863538-11863918 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0362800 |
| Parent gene annotation |
Hypothetical conserved gene. (Os09t0362800-01);Peptidase M1, ala nine aminopeptidase/leukotriene A4 hydrolase domain containing p rotein. (Os09t0362800-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0362500_circ_igg.1 Os09g0362500_circ_igg.2 Os09g0362500_circ_igg.3 Os09g0362500_circ_g.1 Os09g0362500_circ_igg.2 Os09g0362500_circ_igg.3 Os09g0362500_circ_igg.4 Os09g0362500_circ_igg.5 Os09g0362500_circ_ag.1 Os09g0362500_circ_ag.2 Os09g0362500_circ_ag.3 Os09g0362500_circ_ag.4 Os09g0362500_circ_ag.5 EPlOSAG00000024676_circ_ig.1 EPlOSAG00000024676_circ_ig.2 EPlOSAG00000024676_circ_ig.3 Os09g0362800_circ_g.1 Os09g0362800_circ_g.3 Os09g0362800_circ_g.4 Os09g0362800_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0362800-02:2 Os09t0362800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135607065 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11863725-11863651(+) |
| Potential amino acid sequence |
MAMFICRKLGWDPKNSESHLDAMLRPVLLVGLVQLGHDKTISEGVRRFQIFFDDRNTSLPPDTR KVTSSVAKISIDATPELAGEIKQLFIKLLLPTAEYFPAL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |