Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0362500_circ_g.1 |
| ID in PlantcircBase | osa_circ_038965 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 11845453-11846056 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0362500 |
| Parent gene annotation |
Peptidase M1, membrane alanine aminopeptidase family protein. (O s09t0362500-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0362500_circ_igg.1 Os09g0362500_circ_igg.2 Os09g0362500_circ_igg.3 Os09g0362500_circ_igg.2 Os09g0362500_circ_igg.3 Os09g0362500_circ_igg.4 Os09g0362500_circ_igg.5 Os09g0362500_circ_ag.1 Os09g0362500_circ_ag.2 Os09g0362500_circ_ag.3 Os09g0362500_circ_ag.4 Os09g0362500_circ_ag.5 EPlOSAG00000024676_circ_ig.1 EPlOSAG00000024676_circ_ig.2 EPlOSAG00000024676_circ_ig.3 Os09g0362800_circ_g.1 Os09g0362800_circ_g.2 Os09g0362800_circ_g.3 Os09g0362800_circ_g.4 Os09g0362800_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0362500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230764473 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11845491-11845458(+) 11845471-11845974(-) |
| Potential amino acid sequence |
MVAIPDFAAGAMENYGLVTYREVSLLFDEQSSSASFKQNVAITVAHELAHQWFGNLVTMEWWTH LWLNEGFATWMSHLSVDSFFPQWNIWTQFLDSTTSALKLDSQAESHPIELL*(+) MEYQSSSIGWDSACESNLRAEVVLSRNCVQIFH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |