Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039612_circ_g.1 |
ID in PlantcircBase | zma_circ_007487 |
Alias | zma_circ_0001501 |
Organism | Zea mays |
Position | chr3: 9054645-9055908 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d039612 |
Parent gene annotation |
embryo defective 2410 |
Parent gene strand | - |
Alternative splicing | Zm00001d039612_circ_g.2 Zm00001d039612_circ_g.3 Zm00001d039612_circ_g.4 Zm00001d039612_circ_g.5 Zm00001d039612_circ_g.6 Zm00001d039612_circ_g.7 Zm00001d039612_circ_g.8 Zm00001d039612_circ_g.9 Zm00001d039612_circ_g.10 Zm00001d039612_circ_g.11 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d039612_T013:2 Zm00001d039612_T027:2 Zm00001d039612_T001:2 Zm00001d039612_T016:2 Zm00001d039612_T009:2 Zm00001d039612_T007:2 Zm00001d039612_T002:2 Zm00001d039612_T014:2 Zm00001d039612_T023:2 Zm00001d039612_T021:2 Zm00001d039612_T019:2 Zm00001d039612_T011:2 Zm00001d039612_T025:2 Zm00001d039612_T004:2 Zm00001d039612_T015:2 Zm00001d039612_T028:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.216131384 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9055607-9055688(-) |
Potential amino acid sequence |
MEGDLRGTLAKPECDVQIRLLDGTIGGIDLGRAEVLASVTPTSRFVFDANFEPTIQSGHVNIQG SIPVTYVDNSSIEESPEEADGKQGIIRIPVWARDRGSSNEISEARMVRDKTEEGWEFQLAEKLK GLSYNMLEPGEVRIDADIKDGGMMLITALSPYANWLQGYADVLLQVKGTVDQPVVDGSATFNRA IVNSPFLRTPLTNFAGTIQVISNRLCISSMESRVGRKGRLSMKGSLPLKNSEPSANDKIDLKCE VLDIRAKNILRQILISMVKIGNGELTRHSEFSHLVHSAIMMVCVLINYLSRKIMPPFMLMVRFL GRLQIFTLLCLTSQSALYQL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |