Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0271000_circ_g.2 |
| ID in PlantcircBase | osa_circ_023250 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 11319227-11319918 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0271000 |
| Parent gene annotation |
NAD+-dependent histone deacetylase, Seed development (Os04t02710 00-01);Similar to SIR2-like protein. (Os04t0271000-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0271000_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0271000-01:3 Os04t0271000-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015159 |
| PMCS | 0.131072134 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11319788-11319232(+) 11319885-11319266(+) 11319778-11319735(-) 11319269-11319863(-) |
| Potential amino acid sequence |
MTYLIHKSMNDKACLFILRSCLN*(+) MTRLAFLSFGVASTDRRNGKGARKP*(+) MYMMNLRIPPYIRTDFVQISLRNSVKKKCVRWTLRVTSIHGLRAPLPFLRSVEATPKDKKASLV IHGLVDKVGHCWGYVYDESAYPSIYSY*(-) MACEHLCHFFDQLRQLRRIKRQALSFMDLWIR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |