Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0661900_circ_g.2 |
ID in PlantcircBase | osa_circ_025810 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 33779110-33779851 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0661900 |
Parent gene annotation |
Similar to 26S proteasome regulatory particle non-ATPase subunit 8. (Os04t0661900-01);Similar to 26S proteasome regulatory partic le non-ATPase subunit8. (Os04t0661900-02) |
Parent gene strand | + |
Alternative splicing | Os04g0661900_circ_g.1 Os04g0661900_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0661900-02:4 Os04t0661900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007120 osi_circ_017693 |
PMCS | 0.168652448 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33779332-33779118(+) 33779830-33779346(+) |
Potential amino acid sequence |
MFLQQIAAHEVEEIGVEHLLRDVKDTTISTLATEVTSKLAALKGLDARLREIRGYLDLVIEGKL PLNHEILYHLQLCS*(+) MRFCTTCSYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKQSKGVCSCSFSK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |