Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0661900_circ_g.1 |
ID in PlantcircBase | osa_circ_025809 |
Alias | Os_ciR3040 |
Organism | Oryza sativa |
Position | chr4: 33778100-33779206 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os04g0661900 |
Parent gene annotation |
Similar to 26S proteasome regulatory particle non-ATPase subunit 8. (Os04t0661900-01);Similar to 26S proteasome regulatory partic le non-ATPase subunit8. (Os04t0661900-02) |
Parent gene strand | + |
Alternative splicing | Os04g0661900_circ_g.2 Os04g0661900_circ_g.3 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0661900-02:3 Os04t0661900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.158352145 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33778166-33779132(+) 33778288-33779184(-) |
Potential amino acid sequence |
MFSMFKRINAKEHVVGWYSTGPKLRENDLDIHALFNNYVPNPVLVIIDVQPKELGIPTKAYYAV EEVKECRLKRMTRIRGSGSSIIITTNRCFPCSRGSTPRSMLLAGTAPVQNSGRTTWIYTHYSIT MFLTLSW*(+) MLLGVDPLEHGKHRFVVIMIEEPDPRILVILFKRHSLTSSTA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |