Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0661900_circ_g.1 |
| ID in PlantcircBase | osa_circ_025809 |
| Alias | Os_ciR3040 |
| Organism | Oryza sativa |
| Position | chr4: 33778100-33779206 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0661900 |
| Parent gene annotation |
Similar to 26S proteasome regulatory particle non-ATPase subunit 8. (Os04t0661900-01);Similar to 26S proteasome regulatory partic le non-ATPase subunit8. (Os04t0661900-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0661900_circ_g.2 Os04g0661900_circ_g.3 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0661900-02:3 Os04t0661900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.158352145 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33778166-33779132(+) 33778288-33779184(-) |
| Potential amino acid sequence |
MFSMFKRINAKEHVVGWYSTGPKLRENDLDIHALFNNYVPNPVLVIIDVQPKELGIPTKAYYAV EEVKECRLKRMTRIRGSGSSIIITTNRCFPCSRGSTPRSMLLAGTAPVQNSGRTTWIYTHYSIT MFLTLSW*(+) MLLGVDPLEHGKHRFVVIMIEEPDPRILVILFKRHSLTSSTA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |