Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA018554_circ_g.2 |
| ID in PlantcircBase | osi_circ_006041 |
| Alias | 5:7925844|7927192 |
| Organism | Oryza sativa ssp. indica |
| Position | chr5: 7925844-7927192 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA018554 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA018554_circ_g.1 BGIOSGA018554_circ_g.3 BGIOSGA018554_circ_g.4 BGIOSGA018554_circ_g.5 BGIOSGA018554_circ_g.6 BGIOSGA018554_circ_g.7 BGIOSGA018554_circ_g.8 BGIOSGA018554_circ_g.9 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA018554-TA:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7927167-7927155(-) 7927115-7926188(+) |
| Potential amino acid sequence |
MLYVKGPQTEFQRYIRSFNVEVHGPRAHVTKDSKSSKLYDHRPLVLDNDNYQRILQIPKRKGAN FRDLSGVIVGPDNVARLDPTKERVLLPSGRPLVLDCILAYENGKSLRPFGRVWWDEVVGTVLTV PNARMQALIHPAQDRLLTIRESARLQGFPDNYRFRGTVKDRWQMGKAVMKCCM*(-) MTECIFGIQFEDPLHTAFHHGFPHLPPVFDCSTKPVIVRKALQPSTFTNSKQSVLCRMYQGLHT GIWNCQHGSHYLIPPYSTKRS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |