Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0827700_circ_g.11 |
| ID in PlantcircBase | osa_circ_022548 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 34770226-34770741 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0827700 |
| Parent gene annotation |
Similar to ATP-dependent RNA helicase. (Os03t0827700-01);Similar to cDNA clone:J013043E01, full insert sequence. (Os03t0827700-0 2) |
| Parent gene strand | + |
| Alternative splicing | Os03g0827700_circ_g.4 Os03g0827700_circ_g.5 Os03g0827700_circ_g.6 Os03g0827700_circ_g.7 Os03g0827700_circ_g.8 Os03g0827700_circ_g.9 Os03g0827700_circ_g.10 Os03g0827700_circ_g.12 Os03g0827700_circ_g.13 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0827700-02:2 Os03t0827700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.179934722 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34770701-34770738(+) |
| Potential amino acid sequence |
MELPPGNTITKVTKGWVTLQLTRDPGYGRGFFSPRSVTGFLSDVSSAAADEVGKIFLTADEKVQ GAVFDLPEEIARDLLSMELPPGNTITKVTKGWVTLQLTRDPGYGRGFFSPRSVTGFLSDVSSAA ADEVGKIFLTADEKVQGAVFDLPEEIARDLLSMELPPGNTITKVTKGWVTLQLTRDPGYGRGFF SPRSVTGFLSDVSSAAADEVGKIFLTADEKVQGAVFDLPEEIARDLLSMELPPGNTITKVTK(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |