Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0341300_circ_g.3 |
| ID in PlantcircBase | osa_circ_027474 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 16008598-16010473 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0341300 |
| Parent gene annotation |
Similar to guanine nucleotide-binding protein alpha-1 subunit. ( Os05t0341300-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0333150_circ_ag.1 Os05g0333200_circ_g.1 Os05g0333200_circ_ag.1 Os05g0333500_circ_ag.1 Os05g0333500_circ_ag.2 Os05g0333500_circ_ag.3 Os05g0334000_circ_ag.1 Os05g0335100_circ_g.1 Os05g0335401_circ_g.1 Os05g0335401_circ_g.2 Os05g0335401_circ_g.3 Os05g0335401_circ_g.4 Os05g0336000_circ_g.1 Os05g0339000_circ_g.1 Os05g0339000_circ_g.2 Os05g0339000_circ_g.3 Os05g0341300_circ_g.1 Os05g0341300_circ_g.2 Os05g0341300_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0341300-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127437198 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16008919-16010455(-) 16008613-16010400(-) |
| Potential amino acid sequence |
MSFTLSYHHEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQETYLRGSILQLPDCAQYFM ENLDRLAEADYVPTKLMDPEI*(-) MCQQSSWTLRSRRQRASWKERGSGMRAYL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |