Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0341300_circ_g.3 |
ID in PlantcircBase | osa_circ_027474 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 16008598-16010473 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0341300 |
Parent gene annotation |
Similar to guanine nucleotide-binding protein alpha-1 subunit. ( Os05t0341300-01) |
Parent gene strand | - |
Alternative splicing | Os05g0333150_circ_ag.1 Os05g0333200_circ_g.1 Os05g0333200_circ_ag.1 Os05g0333500_circ_ag.1 Os05g0333500_circ_ag.2 Os05g0333500_circ_ag.3 Os05g0334000_circ_ag.1 Os05g0335100_circ_g.1 Os05g0335401_circ_g.1 Os05g0335401_circ_g.2 Os05g0335401_circ_g.3 Os05g0335401_circ_g.4 Os05g0336000_circ_g.1 Os05g0339000_circ_g.1 Os05g0339000_circ_g.2 Os05g0339000_circ_g.3 Os05g0341300_circ_g.1 Os05g0341300_circ_g.2 Os05g0341300_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0341300-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.127437198 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16008919-16010455(-) 16008613-16010400(-) |
Potential amino acid sequence |
MSFTLSYHHEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQETYLRGSILQLPDCAQYFM ENLDRLAEADYVPTKLMDPEI*(-) MCQQSSWTLRSRRQRASWKERGSGMRAYL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |