Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0333200_circ_g.1 |
| ID in PlantcircBase | osa_circ_027459 |
| Alias | Os_ciR9805 |
| Organism | Oryza sativa |
| Position | chr5: 15610331-15610570 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0333200 |
| Parent gene annotation |
Guanine nucleotide-binding protein alpha-1 subunit (GP-alpha-1). (Os05t0333200-00) |
| Parent gene strand | - |
| Alternative splicing | Os05g0333150_circ_ag.1 Os05g0333200_circ_ag.1 Os05g0333500_circ_ag.1 Os05g0333500_circ_ag.2 Os05g0333500_circ_ag.3 Os05g0334000_circ_ag.1 Os05g0335100_circ_g.1 Os05g0335401_circ_g.1 Os05g0335401_circ_g.2 Os05g0335401_circ_g.3 Os05g0335401_circ_g.4 Os05g0336000_circ_g.1 Os05g0339000_circ_g.1 Os05g0339000_circ_g.2 Os05g0339000_circ_g.3 Os05g0341300_circ_g.1 Os05g0341300_circ_g.2 Os05g0341300_circ_g.3 Os05g0341300_circ_g.4 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0333200-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.410071215 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15610382-15610561(+) 15610562-15610567(-) |
| Potential amino acid sequence |
MMFSQNIFALKPSQRVPWSPSFCFLSHLQIASDHIFCIFFSNISNLLRNRMNDVFSKHLCFKTQ SKSSLVSIILFFVSSSNSI*(+) MLFEDETKNRMMETKELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |