Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0333200_circ_g.1 |
ID in PlantcircBase | osa_circ_027459 |
Alias | Os_ciR9805 |
Organism | Oryza sativa |
Position | chr5: 15610331-15610570 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os05g0333200 |
Parent gene annotation |
Guanine nucleotide-binding protein alpha-1 subunit (GP-alpha-1). (Os05t0333200-00) |
Parent gene strand | - |
Alternative splicing | Os05g0333150_circ_ag.1 Os05g0333200_circ_ag.1 Os05g0333500_circ_ag.1 Os05g0333500_circ_ag.2 Os05g0333500_circ_ag.3 Os05g0334000_circ_ag.1 Os05g0335100_circ_g.1 Os05g0335401_circ_g.1 Os05g0335401_circ_g.2 Os05g0335401_circ_g.3 Os05g0335401_circ_g.4 Os05g0336000_circ_g.1 Os05g0339000_circ_g.1 Os05g0339000_circ_g.2 Os05g0339000_circ_g.3 Os05g0341300_circ_g.1 Os05g0341300_circ_g.2 Os05g0341300_circ_g.3 Os05g0341300_circ_g.4 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0333200-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.410071215 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15610382-15610561(+) 15610562-15610567(-) |
Potential amino acid sequence |
MMFSQNIFALKPSQRVPWSPSFCFLSHLQIASDHIFCIFFSNISNLLRNRMNDVFSKHLCFKTQ SKSSLVSIILFFVSSSNSI*(+) MLFEDETKNRMMETKELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |