Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0664300_circ_g.8 |
ID in PlantcircBase | osa_circ_015863 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 26964737-26965583 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0664300 |
Parent gene annotation |
Peptidase S8 and S53, subtilisin, kexin, sedolisin domain contai ning protein. (Os02t0664300-01);Similar to predicted protein. (O s02t0664300-02);Similar to predicted protein. (Os02t0664300-03) |
Parent gene strand | + |
Alternative splicing | Os02g0664300_circ_g.9 Os02g0664300_circ_g.10 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0664300-03:3 Os02t0664300-01:3 Os02t0664300-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.159667405 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26965550-26964739(+) 26965381-26965449(-) |
Potential amino acid sequence |
MWVHHLEKNFQRHDNVQLLEKLKQLVLFIERKLEKKDFIQLSFYSEPDGPTVGNGTFKSSILVP GEPEAFYVGPPSREKLPKA*(+) MKSFFSSFLSINRTNCFSFSNNCTLSCLWKFFSRWWTHIECFWFSWN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |