Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G20580_circ_g.4 |
| ID in PlantcircBase | ath_circ_014040 |
| Alias | At_ciR2795, Ath_circ_FC1270, AT2G20580_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 8860087-8860356 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT2G20580 |
| Parent gene annotation |
RPN1A |
| Parent gene strand | + |
| Alternative splicing | AT2G20580_circ_g.1 AT2G20580_circ_g.2 AT2G20580_circ_g.3 AT2G20580_circ_g.5 |
| Support reads | 3/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G20580.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.191906111 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8860126-8860353(+) |
| Potential amino acid sequence |
MSADGERESLRFRLIGTEGDIGSWGHEYVRNLAGEIAQEYTKRQKYLSDILSVLALTMSADGER ESLRFRLIGTEGDIGSWGHEYVRNLAGEIAQEYTKRQKYLSDILSVLALTMSADGERESLRFRL IGTEGDIGSWGHEYVRNLAGEIAQEYTKRQKYLSDILSVLALTMSADGERESLRFRLIGTEGDI GSWGHEYVRNLAGEIAQEYTKRQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |