Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0794800_circ_g.4 |
| ID in PlantcircBase | osa_circ_022259 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 33055706-33056627 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0794800 |
| Parent gene annotation |
Similar to XRN3. (Os03t0794800-01);Hypothetical conserved gene. (Os03t0794800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0794800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001876 |
| PMCS | 0.12944342 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33056620-33055706(+) |
| Potential amino acid sequence |
MAVVKLGEPGYRVRYYAEKFKEEAELKPIDQVQRDVVQKYVEGLCWVMRYYYQGVCSWQW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |