Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0794800_circ_g.4 |
ID in PlantcircBase | osa_circ_022259 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 33055706-33056627 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0794800 |
Parent gene annotation |
Similar to XRN3. (Os03t0794800-01);Hypothetical conserved gene. (Os03t0794800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0794800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_001876 |
PMCS | 0.12944342 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33056620-33055706(+) |
Potential amino acid sequence |
MAVVKLGEPGYRVRYYAEKFKEEAELKPIDQVQRDVVQKYVEGLCWVMRYYYQGVCSWQW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |