Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0516000_circ_g.1 |
| ID in PlantcircBase | osa_circ_009423 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 18506077-18506543 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0516000 |
| Parent gene annotation |
Similar to Serine palmitoyltransferase (Fragment). (Os11t0516000 -01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0516000_circ_g.2 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0516000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009046 |
| PMCS | 0.479768844 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18506517-18506100(+) 18506185-18506100(+) 18506089-18506392(-) |
| Potential amino acid sequence |
MWWIYCSIEAPAHLEEVLREQIAGGQPRTHRPWKKIIVIVEGIYSMEGELCKLPEIIAVCKKYK AYTYLDEAHSIGAVGQSGRGVCELLGVDPADVDIMMGTFTKSFGSCGGYIAASKPLLIWKRS*( +) MEGELCKLPEIIAVCKKYKAYTYLDEAHSIGAVGQSGRGVCELLGVDPADVDIMMGTFTKSFGS CGGYIAASKPLLIWKRS*(+) MSRGFDAAIYPPHDPNDLVKVPIIMSTSAGSTPRSSQTPRPDWPTAPMLWASSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |