Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0516000_circ_g.1 |
ID in PlantcircBase | osa_circ_009423 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 18506077-18506543 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0516000 |
Parent gene annotation |
Similar to Serine palmitoyltransferase (Fragment). (Os11t0516000 -01) |
Parent gene strand | + |
Alternative splicing | Os11g0516000_circ_g.2 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0516000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009046 |
PMCS | 0.479768844 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18506517-18506100(+) 18506185-18506100(+) 18506089-18506392(-) |
Potential amino acid sequence |
MWWIYCSIEAPAHLEEVLREQIAGGQPRTHRPWKKIIVIVEGIYSMEGELCKLPEIIAVCKKYK AYTYLDEAHSIGAVGQSGRGVCELLGVDPADVDIMMGTFTKSFGSCGGYIAASKPLLIWKRS*( +) MEGELCKLPEIIAVCKKYKAYTYLDEAHSIGAVGQSGRGVCELLGVDPADVDIMMGTFTKSFGS CGGYIAASKPLLIWKRS*(+) MSRGFDAAIYPPHDPNDLVKVPIIMSTSAGSTPRSSQTPRPDWPTAPMLWASSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |