Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0251500_circ_g.2 |
ID in PlantcircBase | osa_circ_018876 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 7985284-7986464 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0251500 |
Parent gene annotation |
Similar to T-cell immune regulator 1 transcript variant 3 (Fragm ent). (Os03t0251500-01) |
Parent gene strand | + |
Alternative splicing | Os03g0251500_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0251500-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147366434 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7985913-7985341(+) 7986324-7985321(+) 7985301-7986369(-) |
Potential amino acid sequence |
MGLAHRDNILKNIASEFENWNRLANKEKIIYHTLNMLSVDVTKKCLVGEGWSPVFATTQIQDAL QRATLDSKSQVGSIFQVLNTTESPPTYFQTNKFTSAFQEIVDAYGLPKMHLLFSTLGIEQKPKF *(+) MRSSELLLIANPKLVQFFKFSTQQNLPRHISRQISSLRLSRKLLMHTGCQKCICYFLLWG*(+) MHFWQPVCINNFLESRSELICLEICRGRFCCVENLKN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |