Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G07890_circ_g.13 |
| ID in PlantcircBase | ath_circ_001216 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 2438709-2438843 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G07890 |
| Parent gene annotation |
MEE6 |
| Parent gene strand | + |
| Alternative splicing | AT1G07890_circ_g.1 AT1G07890_circ_g.2 AT1G07890_circ_g.3 AT1G07890_circ_g.4 AT1G07890_circ_g.5 AT1G07890_circ_g.6 AT1G07890_circ_g.7 AT1G07890_circ_g.8 AT1G07890_circ_g.9 AT1G07890_circ_g.10 AT1G07890_circ_g.11 AT1G07890_circ_g.12 AT1G07890_circ_g.14 AT1G07890_circ_g.15 AT1G07890_circ_g.16 AT1G07890_circ_g.17 AT1G07890_circ_g.18 |
| Support reads | 28 |
| Tissues | leaf, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G07890.2:1 AT1G07890.7:1 AT1G07890.8:1 AT1G07890.3:1 AT1G07890.6:1 AT1G07890.5:1 AT1G07890.1:1 AT1G07890.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223453761 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2438793-2438840(+) 2438816-2438711(-) |
| Potential amino acid sequence |
MGLSDKDIVALSGAHTLDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLDK PQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLDKPQPPPEGRLPDATKGCDHL RDVFAKQMGLSDKDIVALSGAHTL(+) MSLSDKPICLAKTSLKWSQPLVASGRRPSGGGWGLSRVWAPDKATMSLSDKPICLAKTSLKWSQ PLVASGRRPSGGGWGLSRVWAPDKATMSLSDKPICLAKTSLKWSQPLVASGRRPSGGGWGLSRV WAPDKATMSLSDKPICLAKTSLKWSQPLVASGRRPSGGGWGL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |