Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0478200_circ_g.1 |
| ID in PlantcircBase | osa_circ_007136 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 17915789-17916207 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0478200 |
| Parent gene annotation |
Cytoplasmic malate dehydrogenase. (Os10t0478200-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0478200_circ_g.2 Os10g0478200_circ_g.3 Os10g0478200_circ_g.4 Os10g0478200_circ_g.5 Os10g0478200_circ_g.6 Os10g0478200_circ_g.7 Os10g0478200_circ_g.8 Os10g0478200_circ_g.9 Os10g0478200_circ_g.10 Os10g0478200_circ_g.11 Os10g0478200_circ_g.12 Os10g0478200_circ_g.13 Os10g0478200_circ_g.14 Os10g0478200_circ_g.15 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0478200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.557027307 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17916078-17915822(+) 17915816-17915815(+) 17916157-17916199(-) |
| Potential amino acid sequence |
MLRLWLVGSPGRREWKGRMLCQKMSPSTNPKLLLLRLMQPLTARTNWICSCPHDC*(+) MIARGVMLGADQPVILHMLDIPPATESLNGLKMELVDAAFPLLKGIVATTDVVEACTGVNVAVM VGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAAPNCKDKLDMLLSP*(+) METFFDITSFLSIPSFLGNPPTITATFTPVQASTTSVVATIPFKRGNAASTSSILRPLRDSVAG GMSSMCRITGWSAPNITPLAIMGTRAYPICPCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |