Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0478200_circ_g.2 |
ID in PlantcircBase | osa_circ_007137 |
Alias | Os_ciR6792 |
Organism | Oryza sativa |
Position | chr10: 17916032-17916207 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os10g0478200 |
Parent gene annotation |
Cytoplasmic malate dehydrogenase. (Os10t0478200-01) |
Parent gene strand | + |
Alternative splicing | Os10g0478200_circ_g.1 Os10g0478200_circ_g.3 Os10g0478200_circ_g.4 Os10g0478200_circ_g.5 Os10g0478200_circ_g.6 Os10g0478200_circ_g.7 Os10g0478200_circ_g.8 Os10g0478200_circ_g.9 Os10g0478200_circ_g.10 Os10g0478200_circ_g.11 Os10g0478200_circ_g.12 Os10g0478200_circ_g.13 Os10g0478200_circ_g.14 Os10g0478200_circ_g.15 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0478200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.575504924 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17916078-17916047(+) 17916089-17916073(+) 17916157-17916199(-) |
Potential amino acid sequence |
MLRLWLVGSPGRREWKGRMLCQKMSPSTNPKLLLLRLMQPLTARNCRNN*(+) MVGGFPRKEGMERKDVMSKNVSIYKSQASALEAHAAPNCKELSQQLMLWRPALV*(+) METFFDITSFLSIPSFLGNPPTITATFTPVQASTTSVVATIPCS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |