Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0620700_circ_g.8 |
| ID in PlantcircBase | osa_circ_025351 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31548376-31548772 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0620700 |
| Parent gene annotation |
Nucleolin-like protein, Salt stress response (Os04t0620700-01);H ypothetical conserved gene. (Os04t0620700-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0620700_circ_g.1 Os04g0620700_circ_g.2 Os04g0620700_circ_g.3 Os04g0620700_circ_g.4 Os04g0620700_circ_g.5 Os04g0620700_circ_g.6 Os04g0620700_circ_g.7 Os04g0620700_circ_g.9 Os04g0620700_circ_g.10 Os04g0620700_circ_g.11 Os04g0620700_circ_g.12 Os04g0620700_circ_g.13 Os04g0620700_circ_g.14 Os04g0620700_circ_g.15 Os04g0620700_circ_g.16 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0620700-01:3 Os04t0620700-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123845676 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31548703-31548562(+) |
| Potential amino acid sequence |
MNLKIVLMRVLRKVVMNLRKRRLRLLLLKRKKNPVIAQTVTLNLSLILMNQQNLLFLQKGH*(+ ) |
| Sponge-miRNAs | osa-miR319a-3p.2-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |