Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G09340_circ_g.27 |
| ID in PlantcircBase | ath_circ_001676 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 3017677-3017766 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G09340 |
| Parent gene annotation |
chloroplast RNA binding |
| Parent gene strand | + |
| Alternative splicing | AT1G09340_circ_g.3 AT1G09340_circ_g.4 AT1G09340_circ_g.5 AT1G09340_circ_g.6 AT1G09340_circ_g.7 AT1G09340_circ_g.8 AT1G09340_circ_g.9 AT1G09340_circ_g.10 AT1G09340_circ_g.11 AT1G09340_circ_g.12 AT1G09340_circ_g.13 AT1G09340_circ_g.14 AT1G09340_circ_g.15 AT1G09340_circ_g.16 AT1G09340_circ_g.17 AT1G09340_circ_g.18 AT1G09340_circ_g.19 AT1G09340_circ_g.20 AT1G09340_circ_g.21 AT1G09340_circ_g.22 AT1G09340_circ_g.23 AT1G09340_circ_g.24 AT1G09340_circ_g.25 AT1G09340_circ_g.26 |
| Support reads | 4 |
| Tissues | leaf, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G09340.1:1 AT1G09340.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.263883516 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3017710-3017679(-) 3017750-3017679(-) |
| Potential amino acid sequence |
MNNLWLRKPTGLITERECLLLPKVELFRVVMNNLWLRKPTGLITERECLLLPKVELFRVVMNNL WLRKPTGLITERECLLLPKVELFRVVMNNLWLRKPTG(-) MPSSSQSRTLSGCNEQSLAPETHRPDHGKGMPSSSQSRTLSGCNEQSLAPETHRPDHGKGMPSS SQSRTLSGCNEQSLAPETHRPDHGKGMPSSSQSRTLSGCNEQSLAPETHR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |