Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0618600_circ_g.2 |
ID in PlantcircBase | osa_circ_034795 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 25532445-25533321 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0618600 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0618600-01);Similar to FYVE zinc finger family protein. (Os07t0 618600-02) |
Parent gene strand | + |
Alternative splicing | Os07g0618600_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0618600-02:4 Os07t0618600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017349 |
PMCS | 0.1360082 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25532468-25532452(+) 25533290-25532474(+) 25532451-25533251(-) |
Potential amino acid sequence |
MSNDTNDKGPSEYDVTGEGLREAIKSGDIKAVKKLLSQGVDSNYCDKQGFALLHLAALFNQTEI ALILMDNGANIQSKNGQAHS*(+) MEQIFRAKMDKLILKSWPDEQ*(+) MSLSIFALNICSIIHENKSNLCLVK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |