Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0618600_circ_g.2 |
| ID in PlantcircBase | osa_circ_034795 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25532445-25533321 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0618600 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0618600-01);Similar to FYVE zinc finger family protein. (Os07t0 618600-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0618600_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0618600-02:4 Os07t0618600-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017349 |
| PMCS | 0.1360082 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25532468-25532452(+) 25533290-25532474(+) 25532451-25533251(-) |
| Potential amino acid sequence |
MSNDTNDKGPSEYDVTGEGLREAIKSGDIKAVKKLLSQGVDSNYCDKQGFALLHLAALFNQTEI ALILMDNGANIQSKNGQAHS*(+) MEQIFRAKMDKLILKSWPDEQ*(+) MSLSIFALNICSIIHENKSNLCLVK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |