Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0618600_circ_g.1 |
ID in PlantcircBase | osa_circ_034794 |
Alias | Os_ciR11102 |
Organism | Oryza sativa |
Position | chr7: 25531767-25533321 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os07g0618600 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0618600-01);Similar to FYVE zinc finger family protein. (Os07t0 618600-02) |
Parent gene strand | + |
Alternative splicing | Os07g0618600_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0618600-02:6 Os07t0618600-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.218494068 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25531868-25531834(+) 25533290-25531808(+) |
Potential amino acid sequence |
MKNSAFHSAPAVIECKCGMPLCICEAPKPEPVPVKQSISTTSSSAQSNPRPKKSSTNQQSAESS VKKASATSSSNSSSFLNLGLMSNDTNDKGPSEYDVTGEGLREAIKSGDIKAVKKLLSQGVDSNY CDKQGFALLHLAALFNQTEIALILMDNGANIQSKNGQVVVVLAMPVHLGVYLVQLTPFQG*(+) MEQIFRAKMDKSWWCWQCRFTWECI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |