Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0618600_circ_g.1 |
| ID in PlantcircBase | osa_circ_034794 |
| Alias | Os_ciR11102 |
| Organism | Oryza sativa |
| Position | chr7: 25531767-25533321 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0618600 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0618600-01);Similar to FYVE zinc finger family protein. (Os07t0 618600-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0618600_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0618600-02:6 Os07t0618600-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.218494068 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25531868-25531834(+) 25533290-25531808(+) |
| Potential amino acid sequence |
MKNSAFHSAPAVIECKCGMPLCICEAPKPEPVPVKQSISTTSSSAQSNPRPKKSSTNQQSAESS VKKASATSSSNSSSFLNLGLMSNDTNDKGPSEYDVTGEGLREAIKSGDIKAVKKLLSQGVDSNY CDKQGFALLHLAALFNQTEIALILMDNGANIQSKNGQVVVVLAMPVHLGVYLVQLTPFQG*(+) MEQIFRAKMDKSWWCWQCRFTWECI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |