Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0157600_circ_g.1 |
ID in PlantcircBase | osa_circ_008518 |
Alias | Os_ciR7178 |
Organism | Oryza sativa |
Position | chr11: 2791062-2792190 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os11g0157600 |
Parent gene annotation |
Similar to CCT motif family protein, expressed. (Os11t0157600-01 ) |
Parent gene strand | + |
Alternative splicing | Os11g0157600_circ_g.2 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0157600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.181257964 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2791063-2791062(+) 2791111-2792166(-) |
Potential amino acid sequence |
MNSQTNASENNAASNHLSANGGNGSKTGEHSDEESDAQSSGSKREVEIQSAEKLPEVVADGGAG SSREHKIQNGFIDGMNTKSHALKGNDDAPSGNACGDSELQVLSTEKNVRSKFLNGITSAKVAGQ IMDNALRFADSSSLRSSDPGKDLLVVAQTTADRKCKSSALENNAVMENNLSENSKGTATGHAES CPSHFVEINLEKQHHLNGYTNHKLNEKDIFNHSNSSAFSR*(+) MIASRIVFRCICLAIHLEKAEEFE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |